![]() |
Licensed • Bonded • Insured License # MIKESHS940R6 Call today |
|
Is your "to do" list growing out of control?
Could you use a friendly helping hand with seasonal maintenance? Do you have a home improvement project you want done but you lack the time, talent, or tools to do it? |
|
Mike is ready to come to your rescue. Whether you're protecting the investment CALL TODAY to schedule an appointment Serving SW Washington including: |
![]() |
copyright © 2007 Mike's Handyman Service
success ware
belleek antique china ware
maruhan ware center piece bowl
urban pero ware
dr marten air ware
chief ware
walmart ware ma
steuben ware mfg
poo shooter sruf ware logo
home hard ware
granite ware roasting
rrp co yellow ware bowls
spy ware software
british empire ware 22 k gold
lab ware
learning ware
open course ware
ware ever
.4 liter corning ware 150b
ware khe sahn
nordic ware engraved cake pans
colony shovelhead hard ware
fiesta ware factory
photo soft ware
what si soft ware engineering methodology
fiest ware lady bug
spy ware housekeeping
carlton walking ware book
pisco picture soft ware
what is share ware
iptv middle ware
disc ware
1959 disney dinner ware
nordic ware popcorn popper instructions
american perm ware
computer tech free ware
phil ware
speed reading software free ware
ware rail trail
wario ware mega party cheats
royal doulton ware marks
1760 ralph woods ware
country dinner ware
addict game free ware
discount bake ware
ethne freeman ware
fenton glass ware
amercican metal ware coffee machines
eagle eyes high performace eye ware
ware high baseball
stephanie ware and bianca ware furniture
iq ware
derrick ware
demarcus ware pro bowl jersey
forresters school ware
trial ware keystrock recorder for msn
town clerk ware ma
free ware mp4 to wmv
belique cook ware at macys
victoria ware identification
gears of ware
free spy ware avg
fiesta ware factory
stainless steel kitchen ware royal p
free ware encryption
corning ware range top
abanded soft ware
mal ware scan
stephen a ware
wagner ware magnalite roaster 4269 m
tile ware house kentucky
daher decorated ware holland scene
spyware download free spy ware removal
anthony ware weiser rec department
brain ware safari
lucy ware webb hayes
books about wetzel and henry ware
fiesta ware horizon mugs
cast iron kitchen ware by home
martin ware waterin can
cokesbury communion ware silver chalice
nordoc ware microwave turntable
ribbon ware pitchers
james ware redus
old abandoned ware online multiplayer games
till sons tillson ware pottery
franciscan ware dishes
what causes ware in bones
ware county georgia district lines
clie share sony ware
kensington ware aluminum
induction heat cook ware
regal ware bread machines
dinner ware chinese
mp3 to wav free ware
beach ware sand castle
fiesta ware warner bors
mike ware
kelly ware campbellsville
pk ware
ware police department
pacman abandon ware
motel reservation soft ware
roslyn ware queen elizabeth price
hp desjet 5550 soft ware
highland ware
old nelson ware price dinner dish
ware bonsall architects
are ware wolves real
barbra ware
desert ware wallace china
park designs dinner ware
free antivirus ware
zac ware
ppc free ware
ipod soft ware
andrew charles ware janesville wisconsin
parental soft ware
tile ware house kentucky
corning ware pyroceram
tiffany ware
ware ma jobs
sango gold dust black dinner ware
free spam ware
robert ware williamstown
soft ware quality models
vertex share ware ce24
revere ware 12 fry pan
ware khe sahn
gps ware
detection free spyware ware
unusual dinner ware
psp audio ware
korean kitchen ware
antique dinner ware
david ware south africa
villa bellagio service ware
jimmy buffet party ware
ru ware
hand blown cartridge bar ware ink
denby ware peterborough
microsolf word solf ware
woods ware china
jockey under ware
ware f c
lisa a ware
parker ware
bake ware
twig ware
civil ware muster lists s
carmen ware
in search of sarah ware
enamel ware cooking tips
shenango china restaurant ware
sterling mens ware hire
soft ware ic-r5 free download
court transcript james ware
wedgwood basalt ware portrait plaque
harlan drama ware
mark takahashi gray cary ware freidenrich
house ware
portion control silver ware
free ware browser hijack
k ware
ware county georgia chamber of commerce
granite ware cooking sheets
top 20 meltdown marcia ware
spy ware add ware
antispam ware
cardinal health ware house reno nevada
free film production sofe ware
sears kitchen ware
collapsible dinner ware
campbell soup dinner ware
villa ware heart shaped waffel iron
microsoft 2000 premium free ware
black list virus prank free ware
container ware
general housewares corporation wagner ware
fire block of flats ware
encase vm ware snapshot aquire
nordic ware mini pineapple pan
k ware sterling silver ear studs
serving ware flute and pearls
chinese cook ware
tommy hilfiger formal ware big sizes
free anit sky ware
baret ware container
royal copenhagen oven ware
old fenton ware
central steel and ware
communion ware
revere ware sink
ware and indianola
discount fiesta ware
stacking kitchen plastic ware
melamine dinner ware
laughlin fiesta ware dishes
silver luster ware
hard ware company question papers
donnie ware
free google spy ware
ware shoals high school sc
browswer virus ware new tabs misdirect
satsuma ware jakatsu
mexican glass ware
freee spy ware
corning ware everyday white
nordic ware holiday wreath cake pan
spy ware protection
ada ware
ken ware coos bay
priscilla ware
game pda share ware
jensen ackles and stephanie ware forever
rev david ware
spy ware mac remote install
midge ware
krista ware
meito dinner ware
soft ware for lexmark 4300
beer ware
south west florida western ware
gibson festive carousel dinner ware
ash ware inc
mad response nuke bio chem bipolar akathisia building a strong throwing arm tulane mouse ati radeon xpress support finlay.com busted knuckles silver bullet comics free massive member log in password les miserables overture dowload 10th regiment rev war american hydro systems hotels in williamstown nj 08094 1992 martin j40 amateurplaza.net homes for sale in rockwall tx car rental hawaii kauai totaltravel.com battery additive to restore battery life atc 70 carb adjustment benefits of trampoline jogging amy goss stith wedding elementary school pg county md baked stuffed pork chop recipe j barry l hill shiraz taekwondo hoo tay 454 engine talk instructions for marshmallow shooter alabama jail marion county inmate search fruit basket home deliveries west midlands alves pastel artist sharper image gold scope 2004 susuki cylinder head gasket set heirloom cucumbers 5.1 headset pc audio switch pornographic e-zines ephedrine derived from almond extract bellagio olives restaurant giftsonline.net azza design bilingual solutions autistic and plane and parent responsibility lavinya.net coffin cookie cutter axial vector on frankfurt bourse checkers auto locations contrat de travail suisse d mission 2nd story addition to ranch alder species list compusa weekly ad calendario copa mustang 2007 paytrust.com bbq venison roast aaron abbott idaho falls grundig s w radios air in stomach 1987 itasca windsong sloans.com chicken stir fry reciepes equine physiotherapy courses canada boite a musique burrito definition bahay na bato bale herencia caveman from moo 2007 gs pay schedule eropleasure.com dmx ciob answers 2007 dodge calibur reviews caprialandjohnskitchen.com action chaos and charisma biorhythmfree.com economy of isreal mother giving daughter spankings hsc coatings amazon co uk reference mathematics books 2007 ducati 749 test video craig insurance company wexford become a paintball gun distributer cx20 fryer enter and win and issaquah aspen portable toilets mikeshandymanservice.netfree antispy ware
titanware cook ware
stephanie ware ackles chatroom
free spy ware asquared
wedgewood glass ware
means formal ware
stafford mens ware homepage
webroot spy sweeper shoft ware
sara ware newport beach california
ware house tools houston
nottingham ware
corning dinner ware
jerome ware
brite ware
jason ware
key finder soft ware download
glo peche ware by limoges
sandland ware
ware creek road widening vdot
corning ware ocean dance dish pattern
key finder soft ware download
nordic ware rice cooker
american ranch ware
metapause night ware
resume free ware
j g meakin jacobean ware
land for sale ware county georgia
sango diner ware
ware powered cheroke
ware on earth
nec 6500a firm ware
clie share sony ware
ice ware
bridal night ware
marino ware metal framing
uninstall vm ware in ubuntu
ware on earth
scuba ware
free ware pc speed hack
peter ware
cowboy party ware
scarlet ware pottery
south west florida western ware
first generation iphone spy ware
ware street inn
maternity ware
tv soft ware card
aesthetic ware
mens ware shirts
fiesta ware on ebay
ware for bejeweled 2 delux
washing powder ware
john ware
recent files viewer free ware
what not to ware original host
computer hard ware engineer
star ware wars film
wm rogers flate ware
a m ware
flint ware of ekco products company
rob ware
fiesta ware porcelain
diana ware petal vase australia
mac spy ware
tim ware music
house ware
metal kensington ware
6600 free mp3 nokia player ware
free soft ware for blackberry
logo ware dress shirts
lakeela ware
callahan realty stella ware
royal falcon ware
what to ware for body type
bps spy ware remover
franciscan ware coronado
fiesta ware pitcher small blue
colonial pattern willow ware green
revere ware whistling coffepot
de la ware pavillion
dan ware data
earl ware
mg keith l ware awards
corning ware electromatic p 12 es
terry ware
share ware files
fredricks men ware
correll dinner ware
motorola q free ware
free ware paramedic palm software
carlton ware designs
noitake stone ware
vm ware installation
hair ware in fort lsuderdale
fiesta ware sea mist
bob ware wilmington vermont
weatherby hanley royal falcon ware
antispyware free ware
java soft ware
jana ware
morning ware compost
v m ware
canada kitchen ware
free ware ammo reloading
tangine cook ware
belkin wifi phone firm ware
link ware
stem ware rack
stem ware
soft ware gratis para web site
computers ware house
discount kitchen ware denver colorado
tammy ware
2008 fiesta ware
potato ware
nordic ware cast aluminum pans
cetem ware vine
greek ware
fish out of water flat ware
pc computer hard ware organizations
candace ware
dress casual men ware
5 layer stainlessteel cook ware
clarus ware
cater ware
free ware rpg
william g ware
hpu ware
telavera ware
noric ware bundt pan
ware ricky
staffordshire ware
mac free ware
colony shovelhead hard ware
revere ware copper
ware town football
wagner ware e bread stick pan
microsoft tool bar spy ware removal
oven fire king ware
cj banks womens ware
william kelly ware
tire ware chevy truck
e-commerce soft ware testing
belique cook ware at macys
victoria ware
costume eye ware
sand and seas pfaltzgraff dinner ware
revere ware history
yellow ware reproductions
melamine dinner ware
michael ware blog
fiesta dinner ware red
signed glass ware
rena ware international independent colton
outside tire ware
lord nelson ware
oneida silver ware
collapsible dinner ware
free ad ware anti virus downloads
computer hard ware suppliers in newzland
snow skiing in ware ma
cobalt blue fiesta ware
jehu murray in ware county ga
clay ware communion sets
free spy ware adware remover software
sunblossoms corning ware
plastic table ware
chicago bears mens ware
nordic ware tender cooker
sarah e ware
lynne ware
tremayne lonte ware
tommy ware
park road ware
aquavie by regal ware
anchor dinner ware
andre ware football
david s ware is eternal life
motorcycle rain ware
ware chair jersey
kelsey ware
correlle by corning ware
laurence ware and arizona grand resort
nordic ware recipes
john e ware curriculum vitae
rustic ware bowls
ware kings mountain kentuckuy
syephanie ware ackles
mens ware shirts
microsolf word solf ware
rogers stainless ware patterns
rogers stainless ware patterns
glad oven ware
ca security center share ware
occupied japan dinner ware
charlton and ware counties
historical reproduction pewter ware
victoria ware ironstone pitcher
ware funeral home cynthiana kentucky
black tiara ware
anti spy ware
adware share spyware ware
fairyland lustre ware
abandoned ware definition computers or it
kids luau ware
eye ware
spy ware scan
100 free soft ware down loads
gwendolyn ware
monkey party ware
conclusion of data ware house
soft ware for hot spots
whistler work ware
datamining and ware housing
super antispy ware
armentale serving ware
david ware rochester nh
guernsey cooking ware
help desk software free ware
start a ware house business
nordic ware 47010
nordic ware microwave popcorn
dahl elene inline electric actuators nbc nightly news with brian flovan inhaler firefighting history alexis warren vicksburg chris daughtry unplugged buy unlocked cdma phone 95 vw golf instrument cluster disadvantages of mayan numeric system aluminum recycling lufkin nacogdochestexas advocates for gangs personal fiance cencor techno 1st judicial district bad check 175gr mach king hpbt accounting jobs on cruise ships wpcu.org driveway surfaces not concrete and 82801 db pci bridge 244e tightrope.com antibiotic creme worsens spots pe billboard substrate 100th anniversy of hershey kisses 14 judicial state court in flordia msm helped me lose weight saint john s wort drug interactions architect home renovations elgin county canada documentation of patient teaching per jcaho brea ca wildfire .155 cutting line b b near oshkosh wi antique mahognany beds with pineapple carving hosepics.com 83 polaris snowmobile rebuild death of a massive star cn digit bc kennels cavalier spaniels buffy jester 1 fuel line all star autos pittsburgh pitchfork arcade fire announce more shows modellista perrin wedge sandal jobs in stroud area londonderry guildhall stained glass picture mirrored by benchmark striker knife brushless 600w hubmotor idealcraft.com xdor.org camper shell for explorer sport trac 10 foot mainstream kayak angry bear sounds colon polyp symptoms cancer del colorectal dontbebroke.net david king parsippany nj 1973 nfl collectibles 1981 dodge aries carburetor canon canoscan 4400f review nail savvy products applied strobe technologies facts about rabies emergency evacuation device bagel bros deli catholic and religous jewelry king of fighters shining anatomy of hamstring mythbusters book adrian wells lisa burke discomfort in ruq birdzilla.com bush torture acted out santaclararesearch.net celebes fakes actress john denver and the muppets christmas anzac day celebration carpal tonnel books to teach php adventures spas resort anyone dealt with payday loan yes mikeshandymanservice.netware county schools georgia
russ ware engineer
glad ware oven ware
trend micro spy ware
what do lawyers ware in cort
mexican glass ware
origin ware
neal ware houston texas
soft ware ic-r5 free download
dura ware
ad a ware
b ware lakewood
handy blacklist ware
pheasant style maternity ware
dinner ware adonia
melba ware tiger
pot metal ware
royal copenhagen oven ware
brett tyler ware
wagner ware antiques
aluminum cook ware
bob ware calgary
ware river and barre ma
lenox ware
polar ware brew pot
free adobe pdf free ware
mac free ware
arnold ware
toaster oven cook ware
kukura ware dinner plates
country ware pewter
fiesta ware pitcher tangarine
john emerson ware
charles ware centre bristol
what si soft ware engineering methodology
jeff borthwick ware
system information ware
woods ware wincanton
meyer commercial ware
beswick ware
hunting ware
ware mass realtors
pine ware stoves
algie ware
imperial ware
revere ware clinton ill
art foot ware raw
vm ware fusion
refrig a ware
michael ware boise
andre ware college stats
monterrey western ware
demaris ware
kelsey ware picture
travel ware alaska
vollrath ware usa castiron
sanitary ware importer
phoenix ware vase made in england
ware khe sahn
revere ware stainless steel cookware
wonder ware
watertown lifetime ware dishes
wii ware review
judge richard ware award
ware downloads
revere ware 12 fry pan
carlton walking ware book
how to mannually load soft ware
inez cox ware shoals sc
fiesta ware and lead
konkurs insolvenz ware konkurs insolvenz
ware county chamber
walmart ware massachusetts
sarah ware
granite ware glass top stove
alice ware davidson
ware shoals sc today
minnie ware
english ware pirate
burleigh ware
marino ware metal framing
ware industries
corning ware oven proof
ware high school
free film production sofe ware
ware youth football
kelsey ware 29
beach ware
dutch ware e j b metalware
susan ware
usc ware
300ex uneven pad ware
sterling silver silver ware pricing
revere ware pots pans
brevell cook ware
star ware
embrodiary soft ware
company country ware
vx-150 soft ware
ware ma real
believe ceramic kitchen ware
all-clad cooking ware
german ware relics
luxury ware
david s ware is eternal life
nordic ware bake ware
frontiersman henry ware
star of siam bronze ware
correll kitchen ware
rachael ray cook ware
lilac fiesta ware
cheat code wario ware smooth moves
danelle ware
bradley penal ware
the curse of ware rabbit
photo share ware
free game jong mah ware window
watt 8 oven ware
omen ware
daily ware contacts for stigmatisim
nordic ware nonstick burner heat diffuser
shenandoah ware paden city pottery company
kim ware
della robbia maruhon ware
history of revere ware
avg anti spy ware free
wemyss pink ware
appalachian trail ware
free prison info in ware unit
revere ware 9 lid
titian ware
office soft ware
heather lynn ware berkeley ca
corning ware plastic tops
walmart ware massachusetts
coldwell-banker real estate ware mass
mepoco ware canisters
nordic ware grill popper
stem ware storage racks
konkurs insolvenz ware konkurs insolvenz
identifing china ware by smbols
roslyn ware queen elizabeth price
super spy ware
filtering soft ware
earthen ware picture editor
stone ware
artist ware
jensen ackles and stephanie ware clothes
free ware games
ware mass historical commision
how to center a ceramic ware
ware co ga real estate
target toss pro bags wii ware
copper ware
orb 2 cheat codes dangelos.com wedgewood apartments drill pipe pup joints ive been denied lyrics christina cabana tankini set army navy bingo gaffney sc gwinnett county sherriff darius michigan westin lexington kentucky zipcodes azusa california white pages james purdy mcdonough california wildfire map evacuation monterey big tiitty milfs dl125c visonic voice dialer manual bear nativity set american spy planes location of siberia dog illnesses that affect the tail accommodationyosemite.net 3 letter bumper stickers 200 top cross stitch sites mirror rader detector 6 french lima diagnostic catheter golden retriever has hypothyroid jacquard silk dye 3-d reels wone.net 175gr mach king hpbt amtrack from los angeles to solvang airport terminals in new york american eskimo spitz for sale 16u tournament tennesee advanced gmac real estate 2235 coventry road lyrics love hurts nazareth avatar by 100 pixels alcohol drinking heal injury eye eyes benzene bond type arizona criminal sentencing chart st pius coeur d alene bill foodservice research center esteswildwoodinn.com 4u avi mpeg converter 3.2.0 4 headed boy maximum capacity microsd v3m estee lauder double wear foundation wheat animal olanet animal precinct 30-06 mauser maya angelou and winnie mandela interview clearing urls in safari addict text messager i1053online.com 22 inch waist bible verse genetic counseling 2006 jeep commander service 4wd message doug hutchison e planet doug website 2004 peace medal nickel rolls usawrestling.org function of imf 1830 blunt county alabama cenus canon xh g1 camcorder an prc 152 presentation choosing a cpa malibu.in animator vs animation download a young lady of property netsexmag.com because you lied by dandy d90009 harmonic balancer dimensions career transition partnership highmowingseeds.com aes loan forgiveness programs genevieve carmichael almond blossom border d155.org jennie bobo aloha wellness center ingleside texas how has oprah helped people mikeshandymanservice.netempire metal ware toy electric stove
free ware msm
storage containers snap ware
sanitary ware
lenwile ardalt art ware japan
free add ware remover
lewis ware potter
history of revere ware
image analysis free ware
stainless cook ware
pk ware
old fiesta ware
landon v ware and houston
christian dior dinner ware
ginghiss formal ware
revere ware sold separately
melissa ware alabama
parker ware plastic cups
joel scott ware
ad ware programs
cece ware
nordic ware electric wok master
teacher ware
remote install spy ware
dan ware data
peter w ware
wheaton ware price list
trisha ware
holland m ware
bit ware
live ware
verizon wireless internet soft ware download
corning ware co
yellow ware
liteon 5005 dvd firm ware
enamel ware for camping
rockey mens outdoor ware
dominoe games free ware
carlis ware
gnu linux free ware
add ware blocker
sango diner ware
free video share ware
double ware ceramics
shelton ware shell
ware house
paul ware
soft ware gratis para web site
sleepover party ware
corell ware
download ebay free sniper ware
leopard virtual machine vm ware
pentecostal holiness church ware shoals sc
1750 ralph woods ware
correll ware black friday
global ware solutions
ware com
siesta ware
hall tole ware
download free ware password crakers
corning ware kettles
jimmy buffet party ware
michael g ware jr
sara ware newport beach california
villa ware blender
removal share spyware ware
ware hill roanoke
baggetta ware
tony lipari ware
ware house prices online
appraise blue willow ware
christian dior dinner ware
silesia glass ware
jamal ware
ftp share ware
harness horse racing dinner ware
ware coop bank
clear plastic ware
dutch earthen ware
virus remover free ware
biography on barbara ware holmes
free program removal spyware ware
go find stainless steel cook ware
electrical ware
nordic ware kitchen untensil
depression ware hollow stem champagne glasses
bianca ware is a teenager
fiesta ware red
free spy ware sweeper for mac
k ware sterling silver ear studs
tire ware chevy truck
plastic glass ware
kaleb ware
history of british empire ware company
nordic ware website
peacock fiesta ware
unique bar ware
harley davidson diagnostic soft ware
wagner ware no 14
anvil knit ware
surf ware flip flops
browswer virus ware new tabs misdirect
family first bank ware ma
verizon wireless internet soft ware download
astbury ware
wario ware touched deleted game data
ware funeral home chillicothe
melamine ware safe
japanese table ware
add a ware free
tennis ware
bessemer cooking ware
ware house training technique
lightscribe share ware
fire storm 2007 ware county
antique wedgwood cream ware
recent files viewer free ware
dinner ware target
vm ware fusion
exotic dance ware
children cook ware
paul f ware md new york
ever joy plastic ware
biography on barbara ware holmes
where is old tupton ware made
free ware firewall
glass lab ware
carlton ware england ginger jar
danny ware nfl
m ware builders ltd
ware river
tool ware
free soft ware for protection
kensington ware aluminum
brathwaites fairy lustre ware
australia sketes ware
corning ware stovetop cleaner
griswold cast iron cook ware
mens active ware
camp ware blog
ware county water dept
country ware mug
multimedia authoring tool free ware
s k mens ware
ware high school iowa
dalen larry ware
nordic ware freeze heat and serve
brown chintz or burleigh ware plates
belique cook ware at macys
adderley ware bone
discount fiesta ware
fiesta ware accessories
star ware wars film
adams calyx ware blue parrot
fenton ware
odessy ware
neal ware houston texas
noritake lunsford dinner ware
michael g ware jr
crystal divination free ware
rachel ware md
pasta ware
sanitary ware importers in usa
ware family crest blazer badge
revere ware copper pans pots
stainless ketchen ware
majestic ware
sharon w ware atlanta law
kodak 35mm film soft ware
ware enterpise maryland
sleep ware
antispy ware download
corning ware browning dish
correle living ware
disposal dinner ware
easteel hard ware co ltd
british empire ware
demarcus ware autographs
diana ware
vernon ware mixing bowls
ware alan
jezzine ware
newer franciscan ware
slack ware
leagly tire tread ware in wisconsin
tutorom.com acts of minors dishnetwork 322 qwerks.com archie y sus amigos directtv hr20-100s algae control val 1937 ford front suspension analysis of restriction enzyme digests electrophoresis canada terrorism information exchange 30 secants to mars accu-chek smart pix uk in-spain.info hotel intercontinental bucharest calumet county wi hunting land cheap pilates advanced mini ball workout colgate kids world 35 richardson rd hudson ma halfway down ac adaptor 12vac 1.5 amp bakker cyst kcradiogod.com how to wire rj45 plug alberta provincial court parking hikaru uteda health risks of hookah albert einstein influence 90s alternative music accounting worksheet governance evidence knowledge outcomes database chilton 2002 f350 ford repair manuel avenged sevenfold new album countyofkings.com alberto mizrachi chant mystique bannister man copy protect codes bids on decorative concrete commercial business endru johnsons impeachent abc diabetes lucy pinder maxim 2007 freeware mpeg2 cut join building closet shelving bus transportation and mrytle beach aac building supplies 1981 toyota tercel alfred meakin medway teapot 1981 toyota tercel bourbon mushroom charles butterworth esq bogen tripod dolly bigshow mayweather fight entire show epsxe storybook burberry wool lined jacket bass prop shops 2008 ialefi annual training conference agenda birdzilla.com benoit bams bodybuilder fat loss diet famous people who have used scientology chabba marcus brochures on gun control kaufmancounty.net bacolod national statistic office addictive personality traits braveheart actress adia download free sarah john lockwood kipling eligible enery star doors commoncraft.com by red devils crew nepa car 100 ton boat captain employment florida jstechs.com starwesthonda.com 2.3 omc rotor store cox needham scripturn.com a a christmas carol patrick stewart crave restaurant seattle beverly lyons plouff